Skip site navigation (1)Skip section navigation (2)

FreeBSD Manual Pages

  
 
  

home | help
FASTF/TFASTFv3(1)	    General Commands Manual	     FASTF/TFASTFv3(1)

NAME
       fastf3,	fastf3_t  - compare a mixed peptide sequence against a protein
       database	using a	modified fasta algorithm.

       tfastf3,	tfastf3_t - compare a mixed pepide sequence against  a	trans-
       lated DNA database.

DESCRIPTION
       fastf3 and tfastf3 are designed to compare a sequence of	mixed peptides
       to a protein (fastf3) or	translated DNA (tfastf3) database.  Unlike the
       traditional fasta3 search, which	uses a protein or DNA sequence,	fastf3
       and tfastf3 work	with a query sequence of the form:
	    >testf from	mgstm1
	    MGCEN,
	    MIDYP,
	    MLLAY,
	    MLLGY
This  sequence	indicates that a mixture of four peptides has been found, with
'M' in the first position of each one (as from a CNBr cleavage), in the	second
position 'G', 'I', or 'L' (twice), at the third	 position  'C',	 'D',  or  'L'
(twice),  at  the  fourth  position 'E', (included with	the distribution), the
mixture	is deconvolved to form:
     testf    MILGY-----------MLLEY-----------MGDAP-----------
	      :::::	      :::::	      :::::
     GT8.7  MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEK
		    10	      20	30	  40	    50

     testf  --------------------------------------------------

     GT8.7  FKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIV
		    60	      70	80	  90	   100

			   20
     testf  ------------MLCYN
			:::::
     GT8.7  ENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAG
		   110	     120       130	 140	   150

Options
       fastf3 and tfastf3 can accept a query sequence from  the	 unix  "stdin"
       data stream.  This makes	it much	easier to use fasta3 and its relatives
       as part of a WWW	page. To indicate that stdin is	to be used, use	"-" or
       "@" as the query	sequence file name.

       -b #   number of	best scores to show (must be < -E cutoff)

       -d #   number of	best alignments	to show	( must be < -E cutoff)

       -D     turn  on	debugging  mode.   Enables checks on sequence alphabet
	      that cause problems with tfastx3,	tfasty3, tfasta3.

       -E #   Expectation value	limit for displaying  scores  and  alignments.
	      Expectation values for fastf3 and	tfastf3	are not	as accurate as
	      those for	the other fasta3 programs.

       -H     turn off histogram display

       -i     compare  against	only the reverse complement of the library se-
	      quence.

       -L     report long sequence description in alignments

       -m 0,1,2,3,4,5,6,10
	      alignment	display	options

       -n     force query to nucleotide	sequence

       -N #   break long library sequences into	blocks of # residues.	Useful
	      for  bacterial  genomes, which have only one sequence entry.  -N
	      2000 works well for well for bacterial genomes.

       -O file
	      send output to file

       -q/-Q  quiet option; do not prompt for input

       -R file
	      save all scores to statistics file

       -S #   offset substitution matrix values	by  a constant #

       -s name
	      specify substitution  matrix.   BLOSUM50	is  used  by  default;
	      PAM250,  PAM120,	and  BLOSUM62  can  be specified by setting -s
	      P120, P250, or BL62.  With this version, many more  scoring  ma-
	      trices  are  available,  including  BLOSUM80 (BL80), and MDM_10,
	      MDM_20, MDM_40 (M10, M20,	M40). Alternatively, BLASTP1.4	format
	      scoring matrix files can be specified.

       -T #   (threaded,  parallel  only)  number of threads or	workers	to use
	      (set by default to 4 at compile time).

       -t #   Translation table	- tfastf3 can use the BLAST tranlation tables.
	      See		     http://www.ncbi.nih.gov/htbin-post/Taxon-
	      omy/wprintgc?mode=c/.

       -w #   line width for similarity	score, sequence	alignment, output.

       -x "#,#"
	      offsets query, library sequence for numbering alignments

       -z #   Specify statistical calculation. Default is -z 1,	which uses re-
	      gression	against	 the length of the library sequence. -z	0 dis-
	      ables statistics.	 -z 2 uses the ln() length  correction.	 -z  3
	      uses Altschul and	Gish's statistical estimates for specific pro-
	      tein  BLOSUM scoring matrices and	gap penalties. -z 4: an	alter-
	      nate regression method.

       -Z db_size
	      Set the apparent database	size used for expectation value	calcu-
	      lations.

       -1     Sort by "init1" score.

       -3     (TFASTF3 only) use only forward frame translations

Environment variables:
       FASTLIBS
	      location of library choice file (-l FASTLIBS)

       SMATRIX
	      default scoring matrix (-s SMATRIX)

       SRCH_URL
	      the format string	used to	define the  option  to	re-search  the
	      database.

       REF_URL
	      the  format  string  used	to define the option to	lookup the li-
	      brary sequence in	entrez,	or some	other database.

AUTHOR
       Bill Pearson
       wrp@virginia.EDU

				     local		     FASTF/TFASTFv3(1)

Want to link to this manual page? Use this URL:
<https://man.freebsd.org/cgi/man.cgi?query=fastf3&sektion=1&manpath=FreeBSD+Ports+15.1.quarterly>

home | help